General Information

  • ID:  hor007022
  • Uniprot ID:  P35225
  • Protein name:  Interleukin-13
  • Gene name:  gh
  • Organism:  Homo sapiens
  • Family:  IL-4/IL-13 family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005737 cytoplasm; GO:0009897 external side of plasma membrane; GO:0005576 extracellular region; GO:0005615 extracellular space
  • GO BP:  GO:0005144 interleukin-13 receptor binding; GO:0005125 cytokine activity
  • GO CC:  GO:2000231 positive regulation of pancreatic stellate cell proliferation; GO:1901247 negative regulation of lung ciliated cell differentiation; GO:0030890 positive regulation of B cell proliferation; GO:0120162 positive regulation of cold-induced thermogenesis; GO:0032723 positive regulation of connective tissue growth factor production; GO:0010628 positive regulation of gene expression; GO:0002639 positive regulation of immunoglobulin production; GO:0032733 positive regulation of interleukin-10 production; GO:1901251 positive regulation of lung goblet cell differentiation; GO:0043032 positive regulation of macrophage activation; GO:0043306 positive regulation of mast cell degranulation; GO:0050714 positive regulation of protein secretion; GO:0051281 positive regulation of release of sequestered calcium ion into cytosol; GO:0048661 positive regulation of smooth muscle cell proliferation; GO:0071635 negative regulation of transforming growth factor beta production; GO:0006955 immune res

Sequence Information

  • Sequence:  TCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
  • Length:  121
  • Propeptide:  MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
  • Signal peptide:  MHPLLNPLLLALGLMALLLTTVIA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA